Skip to product information
1 of 1

APCDD1, Human (466a.a, HEK293, Fc)

APCDD1, Human (466a.a, HEK293, Fc)

Size

SKU:QM-0202778-01

£74.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    APCDD1 protein, a homodimer, negatively regulates the Wnt signaling pathway, acting cell-autonomously upstream of beta-catenin. Implicated in colorectal tumorigenesis, it interacts with LRP5 and WNT3A, suggesting involvement in complex interactions with Wnt and LRP proteins. APCDD1's pivotal role is evident in its contribution to intricate regulatory mechanisms governing Wnt signaling. APCDD1 Protein, Human (466a.a, HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    147495 (Gene_ID) Q8J025 (L27-H492) (Accession)

  • Smiles

    LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYGRAPGRH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202778-01
5 µgQM-0202778-01
£74.68/ea
£0.00
£74.68/ea £0.00
10 µgQM-0202778-02
10 µgQM-0202778-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0202778-03
50 µgQM-0202778-03
£331.88/ea
£0.00
£331.88/ea £0.00
100 µgQM-0202778-04
100 µgQM-0202778-04
£526.28/ea
£0.00
£526.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

APCDD1, Human (466a.a, HEK293, Fc)

APCDD1, Human (466a.a, HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.