Skip to product information
1 of 1

APCDD1, Human (HEK293, Fc)

APCDD1, Human (HEK293, Fc)

Size

SKU:QM-0169482-01

£74.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The APCDD1 protein inhibits the Wnt signaling pathway and its mutations are associated with hereditary hypotrichosis simplex, causing hair loss. Increased expression of APCDD1 may be related to colorectal cancer development. The gene is highly expressed in the skin (RPKM 30.0), fat (RPKM 14.2), and 13 other tissues. APCDD1 Protein, Human (HEK293, Fc) is the recombinant human-derived APCDD1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    147495 (Gene_ID) Q8J025/NP_694545.1 (L27-G486) (Accession)

  • Smiles

    LLHPDSRSHPRSLEKSAWRAFKESQCHHMLKHLHNGARITVQMPPTIEGHWVSTGCEVRSGPEFITRSYRFYHNNTFKAYQFYYGSNRCTNPTYTLIIRGKIRLRQASWIIRGGTEADYQLHNVQVICHTEAVAEKLGQQVNRTCPGFLADGGPWVQDVAYDLWREENGCECTKAVNFAMHELQLIRVEKQYLHHNLDHLVEELFLGDIHTDATQRMFYRPSSYQPPLQNAKNHDHACIACRIIYRSDEHHPPILPPKADLTIGLHGEWVSQRCEVRPEVLFLTRHFIFHDNNNTWEGHYYHYSDPVCKHPTFSIYARGRYSRGVLSSRVMGGTEFVFKVNHMKVTPMDAATASLLNVFNGNECGAEGSWQVGIQQDVTHTNGCVALGIKLPHTEYEIFKMEQDARGRYLLFNGQRPSDGSSPDRPEKRATSYQMPLVQCASSSPRAEDLAEDSGSSLYG

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169482-01
5 µgQM-0169482-01
£74.68/ea
£0.00
£74.68/ea £0.00
10 µgQM-0169482-02
10 µgQM-0169482-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0169482-03
50 µgQM-0169482-03
£331.88/ea
£0.00
£331.88/ea £0.00
100 µgQM-0169482-04
100 µgQM-0169482-04
£526.28/ea
£0.00
£526.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

APCDD1, Human (HEK293, Fc)

APCDD1, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.