Name: APOC2, Human (His)
Brand: QuantiMol
SKU: QM-0027609-01
Price: 137.5 GBP
Availability: InStock

Product Details

Description
Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II deficiency[1].
Molecular Formula
344 (Gene_ID) P02655 (T23-E101) (Accession)
Smiles
TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEEHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0027609-01	5 µgQM-0027609-01 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

10 µgQM-0027609-02	10 µgQM-0027609-02 £243.19/ea	£0.00	Quantity	£243.19/ea	£0.00

50 µgQM-0027609-03	50 µgQM-0027609-03 £534.79/ea	£0.00	Quantity	£534.79/ea	£0.00

100 µgQM-0027609-04	100 µgQM-0027609-04 £825.17/ea	£0.00	Quantity	£825.17/ea	£0.00

500 µgQM-0027609-05	500 µgQM-0027609-05 £1,915.03/ea	£0.00	Quantity	£1,915.03/ea	£0.00

1 mgQM-0027609-06	1 mgQM-0027609-06 £2,679.26/ea	£0.00	Quantity	£2,679.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

APOC2, Human (His)

APOC2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.