1 1

Apolipoprotein A-I/APOA1, Human (HEK293, His)

Apolipoprotein A-I/APOA1, Human (HEK293, His)

Size

QM-0205763-01

£74.68 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Apolipoprotein A-I Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI[1][2][3].

  • Molecular Formula

    335 (Gene_ID) P02647 (R19-Q267) (Accession)

  • Smiles

    RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQHHHHHH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0205763-01
5 µgQM-0205763-01
£74.68/ea		 £0.00
£74.68/ea £0.00
10 µgQM-0205763-02
10 µgQM-0205763-02
£116.13/ea		 £0.00
£116.13/ea £0.00
50 µgQM-0205763-03
50 µgQM-0205763-03
£327.02/ea		 £0.00
£327.02/ea £0.00
100 µgQM-0205763-04
100 µgQM-0205763-04
£520.20/ea		 £0.00
£520.20/ea £0.00
500 µgQM-0205763-05
500 µgQM-0205763-05
£1,377.99/ea		 £0.00
£1,377.99/ea £0.00
1 mgQM-0205763-06
1 mgQM-0205763-06
£1,932.04/ea		 £0.00
£1,932.04/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Apolipoprotein A-I/APOA1, Human (HEK293, His)

Apolipoprotein A-I/APOA1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.