1 1

Apolipoprotein A-I/APOA1, Mouse (HEK293, Fc)

Apolipoprotein A-I/APOA1, Mouse (HEK293, Fc)

Size

QM-0205370-01

£94.75 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Molecular Formula

    11806 (Gene_ID) Q00623 (W19-Q264) (Accession)

  • Smiles

    WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

  • Purity

    96.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0205370-01
5 µgQM-0205370-01
£94.75/ea		 £0.00
£94.75/ea £0.00
10 µgQM-0205370-02
10 µgQM-0205370-02
£135.25/ea		 £0.00
£135.25/ea £0.00
50 µgQM-0205370-03
50 µgQM-0205370-03
£359.82/ea		 £0.00
£359.82/ea £0.00
100 µgQM-0205370-04
100 µgQM-0205370-04
£548.15/ea		 £0.00
£548.15/ea £0.00
200 µgQM-0205370-05
200 µgQM-0205370-05
£847.04/ea		 £0.00
£847.04/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Apolipoprotein A-I/APOA1, Mouse (HEK293, Fc)

Apolipoprotein A-I/APOA1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.