Skip to product information
1 of 1

Apolipoprotein E/APOE, Mouse (HEK293, His)

Apolipoprotein E/APOE, Mouse (HEK293, His)

Size

SKU:QM-0204169-01

£111.63 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Apolipoprotein E/APOE is a key molecule linking lipid metabolism and neurological function. Apolipoprotein E/APOE gene polymorphisms are closely associated with diseases such as Alzheimer’s disease and atherosclerosis by influencing protein structure and function. Apolipoprotein E/APOE Protein, Mouse (HEK293, His) is a recombinant APOE protein expressed in HEK293 cells, with a C-6*His tag[1][2][3].

  • Molecular Formula

    11816 (Gene_ID) P08226 (E19-Q311) (Accession)

  • Smiles

    EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQHHHHHH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204169-01
5 µgQM-0204169-01
£111.63/ea
£0.00
£111.63/ea £0.00
10 µgQM-0204169-02
10 µgQM-0204169-02
£205.52/ea
£0.00
£205.52/ea £0.00
50 µgQM-0204169-03
50 µgQM-0204169-03
£492.26/ea
£0.00
£492.26/ea £0.00
100 µgQM-0204169-04
100 µgQM-0204169-04
£769.28/ea
£0.00
£769.28/ea £0.00
250 µgQM-0204169-05
250 µgQM-0204169-05
£1,128.92/ea
£0.00
£1,128.92/ea £0.00
500 µgQM-0204169-06
500 µgQM-0204169-06
£1,449.68/ea
£0.00
£1,449.68/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Apolipoprotein E/APOE, Mouse (HEK293, His)

Apolipoprotein E/APOE, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.