Skip to product information
1 of 1

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)

Size

SKU:QM-0194285-01

£115.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Apolipoprotein E/APOE is essential for lipid transport between organs and is a key component of lipoproteins such as chylomicrons and high-density lipoprotein. It binds to cell receptors such as LDLR and VLDLR to promote lipoprotein uptake, and has heparin-binding activity to interact with cell surface proteoglycans. Apolipoprotein E/APOE Protein, Rabbit (His-B2M, Myc) is the recombinant Rabbit-derived Apolipoprotein E/APOE protein, expressed by E. coli , with N-10*His, C-Myc, N-B2M labeled tag.

  • Molecular Formula

    100009337 (Gene_ID) P18287 (T20-Q311) (Accession)

  • Smiles

    TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0194285-01
5 µgQM-0194285-01
£115.00/ea
£0.00
£115.00/ea £0.00
10 µgQM-0194285-02
10 µgQM-0194285-02
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0194285-03
50 µgQM-0194285-03
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc)

Apolipoprotein E/APOE, Rabbit (His-B2M, Myc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.