Apolipoprotein E/APOE, Rat (His)

Name: Apolipoprotein E/APOE, Rat (His)
Brand: QuantiMol
SKU: QM-0179402-01
Price: 277.21 GBP
Availability: InStock

Size 20 µg 50 µg 100 µg

SKU:QM-0179402-01

£277.21 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Apolipoprotein E/APOE is essential for lipid transport and is integral to the production, transformation and clearance of plasma lipoproteins.It interacts with various particles to favor HDL and binds to receptors such as LDLR and VLDLR to promote cellular uptake.Apolipoprotein E/APOE Protein, Rat (His) is the recombinant rat-derived Apolipoprotein E/APOE protein, expressed by E.coli , with N-6*His labeled tag.
Molecular Formula
25728 (Gene_ID) P02650 (E19-Q312) (Accession)
Smiles
EGELEVTDQLPGQSDQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTVLMEDTMTEVKAYKKELEEQLGPVAEETRARLAKEVQAAQARLGADMEDLRNRLGQYRNEVNTMLGQSTEELRSRLSTHLRKMRKRLMRDADDLQKRLAVYKAGAQEGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQALSDRIRGRLEEVGNQARDRLEEVREQMEEVRSKMEEQTQQIRLQAEIFQARIKGWFEPLVEDMQRQWANLMEKIQASVATNSIASTTVPLENQ
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0179402-01	20 µgQM-0179402-01 £277.21/ea	£0.00	Quantity	£277.21/ea	£0.00

50 µgQM-0179402-02	50 µgQM-0179402-02 £481.32/ea	£0.00	Quantity	£481.32/ea	£0.00

100 µgQM-0179402-03	100 µgQM-0179402-03 £697.60/ea	£0.00	Quantity	£697.60/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Apolipoprotein E/APOE, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.