1 1

Apolipoprotein E/APOE2, Human (R154S, R176C, HEK293, C-His)

Apolipoprotein E/APOE2, Human (R154S, R176C, HEK293, C-His)

Size

QM-0205166-01

£76.75 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Apolipoprotein E (APOE) plays a key role in lipoprotein-mediated lipid transport and is a core component in the production, transformation, and clearance of plasma lipoproteins. As an amphipathic molecule, APOE binds to various lipoprotein particles, including chylomicrons, chylomicron remnants, VLDL, and IDL, favoring HDL. Apolipoprotein E/APOE Protein, Human (R154S, R176C, HEK293, C-His) is the recombinant human-derived Apolipoprotein E/APOE protein, expressed by HEK293 , with C-6*His labeled tag and R154S, R176C mutation.

  • Molecular Formula

    348 (Gene_ID) P02649 (K19-H317, R154S, R176C) (Accession)

  • Smiles

    KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVSLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0205166-01
5 µgQM-0205166-01
£76.75/ea		 £0.00
£76.75/ea £0.00
10 µgQM-0205166-02
10 µgQM-0205166-02
£117.25/ea		 £0.00
£117.25/ea £0.00
50 µgQM-0205166-03
50 µgQM-0205166-03
£327.02/ea		 £0.00
£327.02/ea £0.00
100 µgQM-0205166-04
100 µgQM-0205166-04
£520.20/ea		 £0.00
£520.20/ea £0.00
500 µgQM-0205166-05
500 µgQM-0205166-05
£1,323.32/ea		 £0.00
£1,323.32/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Apolipoprotein E/APOE2, Human (R154S, R176C, HEK293, C-His)

Apolipoprotein E/APOE2, Human (R154S, R176C, HEK293, C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.