Name: Apolipoprotein H/APOH, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0204210-01
Price: 58.12 GBP
Availability: InStock

Product Details

Description
Apolipoprotein H Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the C-terminus. Apolipoprotein H (ApoH) is the main target of anti-phospholipid antibodies (aPLs) found in many patients with systemic lupus erythematosus and antiphospholipid syndrome (APS) [1].
Molecular Formula
350 (Gene_ID) P02749 (G20-C345) (Accession)
Smiles
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204210-01	5 µgQM-0204210-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204210-02	10 µgQM-0204210-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0204210-03	50 µgQM-0204210-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

100 µgQM-0204210-04	100 µgQM-0204210-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

250 µgQM-0204210-05	250 µgQM-0204210-05 £658.72/ea	£0.00	Quantity	£658.72/ea	£0.00

500 µgQM-0204210-06	500 µgQM-0204210-06 £1,046.30/ea	£0.00	Quantity	£1,046.30/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Apolipoprotein H/APOH, Human (HEK293, His)

Apolipoprotein H/APOH, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.