1 1

Apolipoprotein M/APOM, Human (166a.a, HEK293, His)

Apolipoprotein M/APOM, Human (166a.a, HEK293, His)

Size

QM-0206019-01

£74.68 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Apolipoprotein M Protein, Human (166a.a, HEK293, His) expresses in HEK293, does not contain signal peptide sequence with a His tag at the N-terminus. Apolipoprotein E (apoE) secreted by HEK cells stably expressing apoE3 or apoE4 (HEK-apoE) binds Aβ, and inhibits Aβ-induced neurotoxicity [1].

  • Molecular Formula

    55937 (Gene_ID) O95445-1 (C23-N188) (Accession)

  • Smiles

    CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
5 µgQM-0206019-01
5 µgQM-0206019-01
£74.68/ea		 £0.00
£74.68/ea £0.00
10 µgQM-0206019-02
10 µgQM-0206019-02
£111.63/ea		 £0.00
£111.63/ea £0.00
50 µgQM-0206019-03
50 µgQM-0206019-03
£316.08/ea		 £0.00
£316.08/ea £0.00
100 µgQM-0206019-04
100 µgQM-0206019-04
£476.46/ea		 £0.00
£476.46/ea £0.00
250 µgQM-0206019-05
250 µgQM-0206019-05
£814.24/ea		 £0.00
£814.24/ea £0.00
500 µgQM-0206019-06
500 µgQM-0206019-06
£1,212.76/ea		 £0.00
£1,212.76/ea £0.00
1 mgQM-0206019-07
1 mgQM-0206019-07
£1,876.14/ea		 £0.00
£1,876.14/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Apolipoprotein M/APOM, Human (166a.a, HEK293, His)

Apolipoprotein M/APOM, Human (166a.a, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.