AQP4, Human (His)

Name: AQP4, Human (His)
Brand: QuantiMol
SKU: QM-0205120-01
Price: 52.94 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0205120-01

£52.94 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The AQP4 protein forms water-specific channels and is involved in brain water balance and solute transport. AQP4 Protein, Human (His) is the recombinant human-derived AQP4, expressed by E. coli, with N-6*His labeled tag. The total length of AQP4 Protein, Human (His) is 71 a.a..
Molecular Formula
361 (Gene_ID) P55087-1 (C253-V323) (Accession)
Smiles
CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Purity
90.6
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205120-01	2 µgQM-0205120-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

5 µgQM-0205120-02	5 µgQM-0205120-02 £70.54/ea	£0.00	Quantity	£70.54/ea	£0.00

10 µgQM-0205120-03	10 µgQM-0205120-03 £99.25/ea	£0.00	Quantity	£99.25/ea	£0.00

50 µgQM-0205120-04	50 µgQM-0205120-04 £257.76/ea	£0.00	Quantity	£257.76/ea	£0.00

100 µgQM-0205120-05	100 µgQM-0205120-05 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

AQP4, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.