Arginase-1/ARG1, Human (C-His)

Name: Arginase-1/ARG1, Human (C-His)
Brand: QuantiMol
SKU: QM-0180576-01
Price: 263.32 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180576-01

£263.32 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Arginase-1 Protein, Human (C-His) expresses in E. coli with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI) -resistant Hep3B tumor cells in mice[1].
Molecular Formula
383 (Gene_ID) P05089 (M1-K322) (Accession)
Smiles
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKHHHHHH
Purity
95.2
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180576-01	10 µgQM-0180576-01 £263.32/ea	£0.00	Quantity	£263.32/ea	£0.00

50 µgQM-0180576-02	50 µgQM-0180576-02 £605.96/ea	£0.00	Quantity	£605.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Arginase-1/ARG1, Human (C-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.