Skip to product information
1 of 1

Arginase-1/ARG1, Human (N-His)

Arginase-1/ARG1, Human (N-His)

Size

SKU:QM-0202380-01

£99.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Arginase-1 (ARG1) protein, crucial in the urea cycle, converts L-arginine to urea and L-ornithine. ARG1 also regulates L-arginine levels outside the liver, impacting immune responses. ARG1's release by granulocytes suppresses T cell and NK cell functions. In ILC2s, ARG1 promotes lung inflammation. However, ARG1's role in human monocytic/macrophage/dendritic cells is unclear. Arginase-1/ARG1 Protein, Human (N-His) is the recombinant human-derived Arginase-1/ARG1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    383 (Gene_ID) P05089 (M1-K322) (Accession)

  • Smiles

    MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

  • Purity

    92.4

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0202380-01
5 µgQM-0202380-01
£99.25/ea
£0.00
£99.25/ea £0.00
10 µgQM-0202380-02
10 µgQM-0202380-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0202380-03
50 µgQM-0202380-03
£426.65/ea
£0.00
£426.65/ea £0.00
100 µgQM-0202380-04
100 µgQM-0202380-04
£691.52/ea
£0.00
£691.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Arginase-1/ARG1, Human (N-His)

Arginase-1/ARG1, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.