ARL2BP, Human (GST)
ARL2BP, Human (GST)
SKU:QM-0087943
Request quote or documents

Product Details
-
Description
The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (GST) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-GST labeled tag.
-
Molecular Formula
23568 (Gene_ID) Q9Y2Y0-1 (M1-H163) (Accession)
-
Smiles
MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
ARL2BP, Human (GST)
ARL2BP, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.