Skip to product information
1 of 1

ARL2BP, Human (GST)

ARL2BP, Human (GST)

Size

SKU:QM-0087943

Price on request
Quantity

Request quote or documents

View full details
  • Description

    The ARL2BP protein cooperates with ARL2 to play a crucial role in the nuclear translocation, retention, and transcriptional activity of STAT3, highlighting its cellular involvement. As a potential effector of ARL2, ARL2BP forms a complex with ARL2, SLC25A6, and ARL3. ARL2BP Protein, Human (GST) is the recombinant human-derived ARL2BP protein, expressed by E. coli , with N-GST labeled tag.

  • Molecular Formula

    23568 (Gene_ID) Q9Y2Y0-1 (M1-H163) (Accession)

  • Smiles

    MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0087943
1 EachQM-0087943
£0.00/ea
£0.00
£0.00/ea £0.00

ARL2BP, Human (GST)

ARL2BP, Human (GST) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.