Artemin, Human

Name: Artemin, Human
Brand: QuantiMol
SKU: QM-0171786-01
Price: 127.38 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0171786-01

£127.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Artemin Protein, Human, a member of the glial cell line-derived neurotrophic factor (GDNF) family, is the ligand for the former orphan receptor GFRalpha3-RET. Artemin is a survival factor for sensory and sympathetic neurons in culture, and also influences these neurons in vivo[1].
Molecular Formula
9048 (Gene_ID) Q5T4W7 (A108-G220) (Accession)
Smiles
AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0171786-01	10 µgQM-0171786-01 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0171786-02	50 µgQM-0171786-02 £381.69/ea	£0.00	Quantity	£381.69/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Artemin, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.