Skip to product information
1 of 1

ASB13, Human (His)

ASB13, Human (His)

Size

SKU:QM-0108447

Price on request
Quantity

Request quote or documents

View full details
  • Description

    ASB13 Protein, Human (His) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins, with an N-terminal His tag[1].

  • Molecular Formula

    79754 (Gene_ID) Q8WXK3-1 (M1-N278) (Accession)

  • Smiles

    HHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0108447
1 EachQM-0108447
£0.00/ea
£0.00
£0.00/ea £0.00

ASB13, Human (His)

ASB13, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.