ATG4A, Human (His)

Name: ATG4A, Human (His)
Brand: QuantiMol
SKU: QM-0203949-01
Price: 125.38 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203949-01

£125.38 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
ATG4A Protein, Human (His) is a recombinant human Autophagy Related 4 Homolog A (ATG4A) expressed in E. coli with a His tag. ATG4A, a member of a family of cysteine proteinases, is a autophagy-regulating protease[1].
Molecular Formula
115201 (Gene_ID) Q8WYN0-1 (M1-V398) (Accession)
Smiles
MESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFHCLQSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Purity
97
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203949-01	5 µgQM-0203949-01 £125.38/ea	£0.00	Quantity	£125.38/ea	£0.00

10 µgQM-0203949-02	10 µgQM-0203949-02 £213.51/ea	£0.00	Quantity	£213.51/ea	£0.00

50 µgQM-0203949-03	50 µgQM-0203949-03 £462.58/ea	£0.00	Quantity	£462.58/ea	£0.00

100 µgQM-0203949-04	100 µgQM-0203949-04 £739.61/ea	£0.00	Quantity	£739.61/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ATG4A, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.