ATG4C, Human (His)

Name: ATG4C, Human (His)
Brand: QuantiMol
SKU: QM-0195530-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0195530-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
ATG4C Protein, Human (His) is a recombinant human Autophagy Related 4 Homolog C (Atg4C) expressed in E. coli with a His tag. Atg4C, a member of a family of cysteine proteinases, is a autophagy-regulating protease[1].
Molecular Formula
84938 (Gene_ID) Q96DT6 (M1-L458) (Accession)
Smiles
MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLLHHHHHH
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0195530-01	5 µgQM-0195530-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0195530-02	10 µgQM-0195530-02 £75.72/ea	£0.00	Quantity	£75.72/ea	£0.00

50 µgQM-0195530-03	50 µgQM-0195530-03 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

ATG4C, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.