Skip to product information
1 of 1

ATP1B1, Human (HEK293, His)

ATP1B1, Human (HEK293, His)

Size

SKU:QM-0201975-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The ATP1B1 protein is the non-catalytic component of ATP hydrolase and promotes Na (+) /K (+) ion exchange across the plasma membrane. Its regulatory role involves the assembly of α/β heterodimers to control sodium pump levels. ATP1B1 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B1 protein, expressed by HEK293 , with N-His labeled tag.

  • Molecular Formula

    481 (Gene_ID) P05026-1 (E63-S303) (Accession)

  • Smiles

    EFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201975-01
5 µgQM-0201975-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0201975-02
10 µgQM-0201975-02
£111.63/ea
£0.00
£111.63/ea £0.00
50 µgQM-0201975-03
50 µgQM-0201975-03
£293.00/ea
£0.00
£293.00/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

ATP1B1, Human (HEK293, His)

ATP1B1, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.