ATP1B2, Human (HEK293, His)
ATP1B2, Human (HEK293, His)
SKU:QM-0203284-01
Couldn't load pickup availability
Request quote or documents
Product Details
-
Description
The ATP1B2 protein is the non-catalytic component of ATP hydrolase and promotes Na (+) /K (+) ion exchange across the plasma membrane. Its role is critical in mediating cell adhesion of neurons and astrocytes, promoting sticky cell interactions. ATP1B2 Protein, Human (HEK293, His) is the recombinant human-derived ATP1B2 protein, expressed by HEK293 , with N-His labeled tag.
-
Molecular Formula
482 (Gene_ID) P14415 (D68-T290) (Accession)
-
Smiles
DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
-
Purity
98
-
Storage Conditions
Stored at -20°C for 2 years
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0055073-01 (10Z,13Z) -Nonadeca-10,13-dienoic acid [CAS 29204-20-4]
- QM-0055025-01 20-O-Acetylcamptothecin [CAS 7688-64-4]
- QM-0055022 3'-Azidomethyi-dGTP [CAS 1048022-06-5]
- QM-0054666 DGTPαS [CAS 82337-56-2]
- QM-0054664 DATPαS [CAS 64145-28-4]
- QM-0054663 3’-O-Acetyl-dATP (sodium)
- QM-0054662 3'-O-Acetyl-dATP [CAS 28120-63-0]
- QM-0054521-01 Methoxycarbonyl Cefadroxil-d6 [CAS 1246819-89-5]
Other industry favorites
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0053863 L- (+) -Ampicillin-d5
- QM-0053811 L-Glutathione reduced-d5 (ammonium)
- QM-0053172 Methacryloyl-CoA [CAS 6008-91-9]
- QM-0053171 3-Hydroxy-2-methylbutyryl-CoA [CAS 6701-38-8]
- QM-0054252 Acetyl-L-carnitine (hydrochloride) -13C3
- QM-0054203-01 MDMB-FUBINACA metabolite M1 [CAS 2693397-47-4]
- QM-0053343-01 2-Bromoamphetamine (hydrochloride) [CAS 861006-36-2]
- QM-0053309-01 3-Oxohexadecanoyl-CoA [CAS 34619-89-1]
ATP1B2, Human (HEK293, His)
ATP1B2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.