ATP5MG, Bovine (Myc, His)
ATP5MG, Bovine (Myc, His)
SKU:QM-0126885
Request quote or documents
Product Details
-
Description
ATP5MG Protein, an essential part of mitochondrial membrane ATP synthase (Complex V), facilitates ATP generation from ADP using the proton gradient established by respiratory chain electron transport complexes. Positioned within the F (0) domain as a minor subunit alongside subunit a, ATP5MG collaborates with various subunits in the overall F-type ATPase complex, including CF (1) and CF (0), to ensure efficient ATP synthesis. ATP5MG Protein, Bovine (Myc, His) is the recombinant bovine-derived ATP5MG protein, expressed by E. coli , with N-His, C-Myc labeled tag.
-
Molecular Formula
515696 (Gene_ID) Q28852 (A2-V103) (Accession)
-
Smiles
AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0055073-01 (10Z,13Z) -Nonadeca-10,13-dienoic acid [CAS 29204-20-4]
- QM-0055025-01 20-O-Acetylcamptothecin [CAS 7688-64-4]
- QM-0055022 3'-Azidomethyi-dGTP [CAS 1048022-06-5]
- QM-0054666 DGTPαS [CAS 82337-56-2]
- QM-0054664 DATPαS [CAS 64145-28-4]
- QM-0054663 3’-O-Acetyl-dATP (sodium)
- QM-0054662 3'-O-Acetyl-dATP [CAS 28120-63-0]
- QM-0054521-01 Methoxycarbonyl Cefadroxil-d6 [CAS 1246819-89-5]
Other industry favorites
- QM-0055937 (R) -Camphor-10-sulfonic acid (Standard) [CAS 35963-20-3]
- QM-0055894-01 (+) -Camphor-10-sulfonic acid [CAS 3144-16-9]
- QM-0053863 L- (+) -Ampicillin-d5
- QM-0053811 L-Glutathione reduced-d5 (ammonium)
- QM-0053172 Methacryloyl-CoA [CAS 6008-91-9]
- QM-0053171 3-Hydroxy-2-methylbutyryl-CoA [CAS 6701-38-8]
- QM-0054252 Acetyl-L-carnitine (hydrochloride) -13C3
- QM-0054203-01 MDMB-FUBINACA metabolite M1 [CAS 2693397-47-4]
- QM-0053343-01 2-Bromoamphetamine (hydrochloride) [CAS 861006-36-2]
- QM-0053309-01 3-Oxohexadecanoyl-CoA [CAS 34619-89-1]
ATP5MG, Bovine (Myc, His)
ATP5MG, Bovine (Myc, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.