B7-1/CD80, Cynomolgus (HEK293, His)

Name: B7-1/CD80, Cynomolgus (HEK293, His)
Brand: QuantiMol
SKU: QM-0171950-01
Price: 107.13 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0171950-01

£107.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
CD80 is a costimulatory cytokine for cancer immunity that is activated by binding to CD28 or CTLA-4. Tumor immune evasion occurs when CD80 expression is low. The increased expression of CD80 induced by TP53 stimulates anti-tumor immune responses. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
102140078 (Gene_ID) G7NXN7 (V35-N242) (Accession)
Smiles
VATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAISTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0171950-01	10 µgQM-0171950-01 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0171950-02	50 µgQM-0171950-02 £210.38/ea	£0.00	Quantity	£210.38/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

B7-1/CD80, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.