Skip to product information
1 of 1

B7-1/CD80, Macaca nemestrina (HEK293, His)

B7-1/CD80, Macaca nemestrina (HEK293, His)

Size

SKU:QM-0205972-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    B7-1/CD80 Protein is pivotal in providing the costimulatory signal crucial for T lymphocyte activation. T-cell proliferation and cytokine production hinge on the binding of CD28 or CTLA-4 to this receptor. As a crucial immune response mediator, B7-1/CD80 facilitates dynamic interplay between T cells and regulatory receptors, influencing essential processes for T lymphocyte activation and regulation in the immune system. B7-1/CD80 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived B7-1/CD80 protein, expressed by HEK293 , with C-His labeled tag.

  • Molecular Formula

    / (Gene_ID) O77684/AAC31555 (V35-N242) (Accession)

  • Smiles

    VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVMLSVKADFPTPSITDFEIPPSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYTVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTPKQEHFPDN

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205972-01
2 µgQM-0205972-01
£52.94/ea
£0.00
£52.94/ea £0.00
5 µgQM-0205972-02
5 µgQM-0205972-02
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0205972-03
10 µgQM-0205972-03
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0205972-04
50 µgQM-0205972-04
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0205972-05
100 µgQM-0205972-05
£327.02/ea
£0.00
£327.02/ea £0.00
500 µgQM-0205972-06
500 µgQM-0205972-06
£879.85/ea
£0.00
£879.85/ea £0.00
1 mgQM-0205972-07
1 mgQM-0205972-07
£1,377.99/ea
£0.00
£1,377.99/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

B7-1/CD80, Macaca nemestrina (HEK293, His)

B7-1/CD80, Macaca nemestrina (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.