Skip to product information
1 of 1

B7-H4, Rhesus macaque (HEK293, His)

B7-H4, Rhesus macaque (HEK293, His)

Size

SKU:QM-0191695-01

£97.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    B7-H4 Protein, Rhesus macaque (HEK293, His) may participate in negative regulation of cell-mediated immunity in peripheral tissues. Cell-associated B7-H4 could also inhibit T cell response. B7-H4 acts as a morphogenic factor for cancer cells[1][2][3].

  • Molecular Formula

    714123 (Gene_ID) F7B770 (F29-A258) (Accession)

  • Smiles

    FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVIGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKAHHHHHH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0191695-01
10 µgQM-0191695-01
£97.00/ea
£0.00
£97.00/ea £0.00
50 µgQM-0191695-02
50 µgQM-0191695-02
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

B7-H4, Rhesus macaque (HEK293, His)

B7-H4, Rhesus macaque (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.