BCAS2, Human (His, T7)

Name: BCAS2, Human (His, T7)
Brand: QuantiMol
SKU: QM-0203194-01
Price: 97.0 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203194-01

£97.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BCAS2 Protein, Human (His, T7) plays crucial roles in pre-mRNA splicing and androgen receptor transcription. BCAS2 helps repair radiation-induced DSBs efficiently in both human PCa cells and Drosophila[1][2].
Molecular Formula
10286 (Gene_ID) O75934 (A2-F225) (Accession)
Smiles
ASMTGGQQMGAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203194-01	5 µgQM-0203194-01 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

10 µgQM-0203194-02	10 µgQM-0203194-02 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0203194-03	50 µgQM-0203194-03 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

100 µgQM-0203194-04	100 µgQM-0203194-04 £614.98/ea	£0.00	Quantity	£614.98/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BCAS2, Human (His, T7) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.