Skip to product information
1 of 1

BCL2, Human (His)

BCL2, Human (His)

Size

SKU:QM-0169437-01

£274.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BCL2 Protein regulates the mitochondrial membrane permeability, and inhibits the caspase activity, thereby suppressing the apoptosis in various cell types. BCL2 Protein interacts with BECN1 and AMBRA1, and inhibits the autophagy. BCL2 Protein, Human (His) is the human-derived resombinant BCL2 Protein that is expressed in in E. coli with a His tag at the C-terminus.

  • Molecular Formula

    596 (Gene_ID) P10415-1 (M1-D211) (Accession)

  • Smiles

    MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
50 µgQM-0169437-01
50 µgQM-0169437-01
£274.26/ea
£0.00
£274.26/ea £0.00
100 µgQM-0169437-02
100 µgQM-0169437-02
£395.76/ea
£0.00
£395.76/ea £0.00
500 µgQM-0169437-03
500 µgQM-0169437-03
£971.67/ea
£0.00
£971.67/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BCL2, Human (His)

BCL2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.