BCL2, Mouse (His)

Name: BCL2, Mouse (His)
Brand: QuantiMol
SKU: QM-0194776-01
Price: 101.5 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0194776-01

£101.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1) . BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
12043 (Gene_ID) P10417-1 (G5-P205) (Accession)
Smiles
GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP
Purity
90
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0194776-01	5 µgQM-0194776-01 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

10 µgQM-0194776-02	10 µgQM-0194776-02 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

50 µgQM-0194776-03	50 µgQM-0194776-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BCL2, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.