Skip to product information
1 of 1

BCL2A1, Human (His)

BCL2A1, Human (His)

Size

SKU:QM-0201353-01

£72.61 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The BCL2A1 protein plays a critical role in resisting apoptosis triggered by IL-3 deprivation, suggesting its importance in the response of hematopoietic cells to external signals and may be involved in protecting endothelial cell survival during infection. It also inhibits serum starvation-induced apoptosis in mammary epithelial cells (HC11) . BCL2A1 Protein, Human (His) is the recombinant human-derived BCL2A1 protein, expressed by E. coli , with N-His labeled tag.

  • Molecular Formula

    597 (Gene_ID) Q16548 (M1-S152) (Accession)

  • Smiles

    MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0201353-01
5 µgQM-0201353-01
£72.61/ea
£0.00
£72.61/ea £0.00
10 µgQM-0201353-02
10 µgQM-0201353-02
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0201353-03
50 µgQM-0201353-03
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BCL2A1, Human (His)

BCL2A1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.