Skip to product information
1 of 1

BCMA/TNFRSF17, Cynomolgus (HEK293, His)

BCMA/TNFRSF17, Cynomolgus (HEK293, His)

Size

SKU:QM-0131229

Price on request
Quantity

Request quote or documents

View full details
  • Description

    B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Cynomolgus (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 53 amino acids (M1-A53) and is produced in HEK293 cells.

  • Molecular Formula

    102145399 (Gene_ID) G7Q0I4 (M1-A53) (Accession)

  • Smiles

    MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0131229
1 EachQM-0131229
£0.00/ea
£0.00
£0.00/ea £0.00

BCMA/TNFRSF17, Cynomolgus (HEK293, His)

BCMA/TNFRSF17, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.