Skip to product information
1 of 1

BCMA/TNFRSF17, Human (P.pastoris, His)

BCMA/TNFRSF17, Human (P.pastoris, His)

Size

SKU:QM-0093169-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (P.pastoris, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in P. pastoris.

  • Molecular Formula

    608 (Gene_ID) Q02223 (M1-A54) (Accession)

  • Smiles

    MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAHHHHHH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0093169-01
10 µgQM-0093169-01
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0093169-02
50 µgQM-0093169-02
£249.26/ea
£0.00
£249.26/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BCMA/TNFRSF17, Human (P.pastoris, His)

BCMA/TNFRSF17, Human (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.