BD-2, Human

Name: BD-2, Human
Brand: QuantiMol
SKU: QM-0204466-01
Price: 66.4 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0204466-01

£66.40 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BD-2 Protein, Human is an anti-microbial peptide that participates in the response to microbial invasion.
Molecular Formula
1673 (Gene_ID) O15263 (G24-P64) (Accession)
Smiles
GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204466-01	5 µgQM-0204466-01 £66.40/ea	£0.00	Quantity	£66.40/ea	£0.00

10 µgQM-0204466-02	10 µgQM-0204466-02 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

50 µgQM-0204466-03	50 µgQM-0204466-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

100 µgQM-0204466-04	100 µgQM-0204466-04 £368.33/ea	£0.00	Quantity	£368.33/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BD-2, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.