BD-4, Human

Name: BD-4, Human
Brand: QuantiMol
SKU: QM-0169776-01
Price: 69.5 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0169776-01

£69.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BD-4 Protein, Human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity.
Molecular Formula
140596 (Gene_ID) Q8WTQ1 (E23-P72) (Accession)
Smiles
EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0169776-01	5 µgQM-0169776-01 £69.50/ea	£0.00	Quantity	£69.50/ea	£0.00

10 µgQM-0169776-02	10 µgQM-0169776-02 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0169776-03	50 µgQM-0169776-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0169776-04	100 µgQM-0169776-04 £520.20/ea	£0.00	Quantity	£520.20/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BD-4, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.