BD-4, Rat

Name: BD-4, Rat
Brand: QuantiMol
SKU: QM-0195573-01
Price: 139.75 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg

SKU:QM-0195573-01

£139.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BD-4 Protein, Rat is an inducible peptide with a broad spectrum antimicrobial activity.
Molecular Formula
64389 (Gene_ID) O88514 (Q23-K63) (Accession)
Smiles
QSINNPITCLTKGGVCWGPCTGGFRQIGTCGLPRVRCCKKK
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0195573-01	5 µgQM-0195573-01 £139.75/ea	£0.00	Quantity	£139.75/ea	£0.00

10 µgQM-0195573-02	10 µgQM-0195573-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0195573-03	50 µgQM-0195573-03 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BD-4, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.