BDNF, Human (CHO)

Name: BDNF, Human (CHO)
Brand: QuantiMol
SKU: QM-0204049-01
Price: 137.5 GBP
Availability: InStock

Size 5 µg 10 µg 25 µg 50 µg

SKU:QM-0204049-01

£137.50 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
BDNF Protein, Human (CHO) is a neurotrophin binding to the high-affinity tropomyosin-related receptor kinase B (TrkB) receptor to regulate neurodevelopmental processes, including neuronal survival, neuronal differentiation, and synaptic plasticity.
Molecular Formula
627 (Gene_ID) P23560-1 (H129-R247) (Accession)
Smiles
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0204049-01	5 µgQM-0204049-01 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

10 µgQM-0204049-02	10 µgQM-0204049-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

25 µgQM-0204049-03	25 µgQM-0204049-03 £454.60/ea	£0.00	Quantity	£454.60/ea	£0.00

50 µgQM-0204049-04	50 µgQM-0204049-04 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

BDNF, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.