Beta-NGF, Human (CHO)

Name: Beta-NGF, Human (CHO)
Brand: QuantiMol
SKU: QM-0179506-01
Price: 188.51 GBP
Availability: InStock

Size 50 µg 100 µg

SKU:QM-0179506-01

£188.51 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Human (CHO) is produced by CHO cells (S122-R239), with tag free.
Molecular Formula
4803 (Gene_ID) P01138 (S122-R239) (Accession)
Smiles
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
50 µgQM-0179506-01	50 µgQM-0179506-01 £188.51/ea	£0.00	Quantity	£188.51/ea	£0.00

100 µgQM-0179506-02	100 µgQM-0179506-02 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Beta-NGF, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.