Beta-NGF, Mouse (CHO)

Name: Beta-NGF, Mouse (CHO)
Brand: QuantiMol
SKU: QM-0196030-01
Price: 117.25 GBP
Availability: InStock

Size 5 µg 20 µg 100 µg

SKU:QM-0196030-01

£117.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss[1][2][3]. Beta-NGF Protein, Mouse (CHO) is produced by CHO cells (S122-G241), with tag free.
Molecular Formula
18049 (Gene_ID) P01139 (S122-G241) (Accession)
Smiles
SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0196030-01	5 µgQM-0196030-01 £117.25/ea	£0.00	Quantity	£117.25/ea	£0.00

20 µgQM-0196030-02	20 µgQM-0196030-02 £255.34/ea	£0.00	Quantity	£255.34/ea	£0.00

100 µgQM-0196030-03	100 µgQM-0196030-03 £580.96/ea	£0.00	Quantity	£580.96/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Beta-NGF, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.