Betacellulin/BTC, Mouse (HEK293)

Name: Betacellulin/BTC, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0192865-01
Price: 122.88 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0192865-01

£122.88 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Probetacellulin Protein, Mouse (HEK293), a member of the epidermal growth factor (EGF) family, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.
Molecular Formula
12223 (Gene_ID) Q05928 (D32-Y111) (Accession)
Smiles
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0192865-01	10 µgQM-0192865-01 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0192865-02	50 µgQM-0192865-02 £337.95/ea	£0.00	Quantity	£337.95/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Betacellulin/BTC, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.