Betacellulin/BTC, Mouse (N-His)

Name: Betacellulin/BTC, Mouse (N-His)
Brand: QuantiMol
SKU: QM-0203795-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203795-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Probetacellulin Protein, Mouse, induces differentiation of pancreatic β-cells and promotes regeneration of β-cells in experimental diabetes.
Molecular Formula
12223 (Gene_ID) Q05928 (D32-Y111) (Accession)
Smiles
DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFY
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203795-01	2 µgQM-0203795-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

5 µgQM-0203795-02	5 µgQM-0203795-02 £78.82/ea	£0.00	Quantity	£78.82/ea	£0.00

10 µgQM-0203795-03	10 µgQM-0203795-03 £107.13/ea	£0.00	Quantity	£107.13/ea	£0.00

50 µgQM-0203795-04	50 µgQM-0203795-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

100 µgQM-0203795-05	100 µgQM-0203795-05 £492.26/ea	£0.00	Quantity	£492.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Betacellulin/BTC, Mouse (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.