Skip to product information
1 of 1

BGLAP, Mouse (His-SUMO)

BGLAP, Mouse (His-SUMO)

Size

SKU:QM-0169839-01

£210.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The BGLAP protein, in its carboxylated state, forms an important part of the bone matrix and acts as a negative regulator of bone formation. It limits bone formation and preserves processes such as resorption and mineralization. BGLAP Protein, Mouse (His-SUMO) is the recombinant mouse-derived BGLAP protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

  • Molecular Formula

    12096 (Gene_ID) P86546 (Y50-I95) (Accession)

  • Smiles

    YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0169839-01
5 µgQM-0169839-01
£210.38/ea
£0.00
£210.38/ea £0.00
10 µgQM-0169839-02
10 µgQM-0169839-02
£320.94/ea
£0.00
£320.94/ea £0.00
50 µgQM-0169839-03
50 µgQM-0169839-03
£625.91/ea
£0.00
£625.91/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BGLAP, Mouse (His-SUMO)

BGLAP, Mouse (His-SUMO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.