Skip to product information
1 of 1

BID, Human

BID, Human

Size

SKU:QM-0193328-01

£137.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BID Protein, Human expresses in E. coli. The BH3-only protein BID, a pro-apoptotic member of the Bcl-2 family, was initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways[1].

  • Molecular Formula

    637 (Gene_ID) P55957 (M1-D195) (Accession)

  • Smiles

    MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0193328-01
10 µgQM-0193328-01
£137.75/ea
£0.00
£137.75/ea £0.00
50 µgQM-0193328-02
50 µgQM-0193328-02
£341.08/ea
£0.00
£341.08/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BID, Human

BID, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.