Skip to product information
1 of 1

BID, Mouse (His)

BID, Mouse (His)

Size

SKU:QM-0204325-01

£74.68 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BID Protein, a pro-apoptotic member of the Bcl-2 family, is initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways. BID is susceptible to proteolytic cleavage by caspases, calpains, Granzyme B and cathepsins. BID Protein, Mouse (His) is the recombinant mouse-derived BID protein, expressed by E. coli , with C-His labeled tag.

  • Molecular Formula

    12122 (Gene_ID) EDK99650.1 (A1-S195) (Accession)

  • Smiles

    AGSAWSYTACAMDSEVSNGSGLGAKHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFS

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0204325-01
5 µgQM-0204325-01
£74.68/ea
£0.00
£74.68/ea £0.00
10 µgQM-0204325-02
10 µgQM-0204325-02
£117.25/ea
£0.00
£117.25/ea £0.00
50 µgQM-0204325-03
50 µgQM-0204325-03
£331.88/ea
£0.00
£331.88/ea £0.00
100 µgQM-0204325-04
100 µgQM-0204325-04
£526.28/ea
£0.00
£526.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BID, Mouse (His)

BID, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.