1 1

BLNK, Human (His)

BLNK, Human (His)

Size

QM-0082620

Price on request

Request quote or documents

View full details

Product Details

  • Description

    BLNK Protein, Human (His) expresses in E. coliwith a His tag. B-cell linker protein (BLNK) is an adaptor protein that orchestrates signalling downstream of B-cell receptors[1].

  • Molecular Formula

    29760 (Gene_ID) AAH18906 (M1-S456) (Accession)

  • Smiles

    MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSHHHHHH

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
1 EachQM-0082620
1 EachQM-0082620
£0.00/ea		 £0.00
£0.00/ea £0.00

Related Products

Other industry favorites

BLNK, Human (His)

BLNK, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.