Skip to product information
1 of 1

Blot21, Blomia tropicalis (His)

Blot21, Blomia tropicalis (His)

Size

SKU:QM-0205857-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Blot21 Protein, representing a new group of allergens, is an important Blomia tropicalis allergen. Allergenic components from Blomia tropicalis are important triggers of allergies in the tropics. Blot21 is a paralog of the group 5 allergen Blot5. Blot21 has moderate sequence identity (40.7%) to Blot5 and low to moderate cross-reactivity to Blot5. Blot21 Protein, Blomia tropicalis (His) is the recombinant Blot21 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    / (Gene_ID) AAX34047.1 (L17-E129) (Accession)

  • Smiles

    LPVSNDNFRHEFDHMIVNTATQRFHEIEKFLLHITHEVDDLEKTGNKDEKARLLRELTVSEAFIEGSRGYFQRELKRTDLDLLEKFNFEAALATGDLLLKDLKALQKRVQDSE

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0205857-01
5 µgQM-0205857-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0205857-02
10 µgQM-0205857-02
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0205857-03
50 µgQM-0205857-03
£359.82/ea
£0.00
£359.82/ea £0.00
100 µgQM-0205857-04
100 µgQM-0205857-04
£576.10/ea
£0.00
£576.10/ea £0.00
500 µgQM-0205857-05
500 µgQM-0205857-05
£1,544.45/ea
£0.00
£1,544.45/ea £0.00
1 mgQM-0205857-06
1 mgQM-0205857-06
£2,595.43/ea
£0.00
£2,595.43/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Blot21, Blomia tropicalis (His)

Blot21, Blomia tropicalis (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.