Skip to product information
1 of 1

BMP-7, Human

BMP-7, Human

Size

SKU:QM-0184010-01

£359.82 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGFβ family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4]. The total length of human BMP-7 protein is 431 amino acids (M1-H431), with 4 glycosylation domains. BMP-7 Protein, Human has a total length of 139 amino acids (S293-H431), is expressed in E. coli cells.

  • Molecular Formula

    655 (Gene_ID) P18075 (S293-H431) (Accession)

  • Smiles

    STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0184010-01
10 µgQM-0184010-01
£359.82/ea
£0.00
£359.82/ea £0.00
50 µgQM-0184010-02
50 µgQM-0184010-02
£979.48/ea
£0.00
£979.48/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BMP-7, Human

BMP-7, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.