Skip to product information
1 of 1

BMP-7, Human (His)

BMP-7, Human (His)

Size

SKU:QM-0205966-01

£94.75 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    Bone morphogenetic protein 7 (BMP-7) is a polymorphic ligand protein belonging to the TGF-β family. BMP-7 is involved in regulating the proliferation, invasion and migration of cancer cells and is associated with a variety of human tumors[1]. BMP-7 binds ALK2 or ACVR2A/BMPR2 excitation signal, which is terminated by SMADs regulation[2]. BMP-7 is involved in the BMP-7-SMad1/5/9 signaling pathway, which is associated with the epithelial-mesenchymal transition (EMT) process[1]. BMP-7 also eliminates vascular inflammation, maintains vascular integrity[3], reduces vascular calcification, and stimulates in situ phosphate ossification deposition[4].

  • Molecular Formula

    655 (Gene_ID) P18075 (S293-H431) (Accession)

  • Smiles

    STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205966-01
2 µgQM-0205966-01
£94.75/ea
£0.00
£94.75/ea £0.00
5 µgQM-0205966-02
5 µgQM-0205966-02
£147.63/ea
£0.00
£147.63/ea £0.00
10 µgQM-0205966-03
10 µgQM-0205966-03
£260.19/ea
£0.00
£260.19/ea £0.00
50 µgQM-0205966-04
50 µgQM-0205966-04
£604.04/ea
£0.00
£604.04/ea £0.00
100 µgQM-0205966-05
100 µgQM-0205966-05
£990.41/ea
£0.00
£990.41/ea £0.00
250 µgQM-0205966-06
250 µgQM-0205966-06
£1,743.71/ea
£0.00
£1,743.71/ea £0.00
500 µgQM-0205966-07
500 µgQM-0205966-07
£2,595.43/ea
£0.00
£2,595.43/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BMP-7, Human (His)

BMP-7, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.