Skip to product information
1 of 1

BMPR-II, Human (HEK293, His)

BMPR-II, Human (HEK293, His)

Size

SKU:QM-0184600-01

£91.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BMP Type II Receptor (BMPR2) is a type II member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. BMPR2 is highly expressed in the heart and liver, and involves in osteogenesis and cell differentiation, essential for embryogenesis, development, and adult tissue homeostasis[1][2]. BMPR2 is associated with tubulin stability, the inhibition of BMPR2 destabilizes the microtubules promoting cell death of cancer cells that involves the activation of the lysosomes[3]. Human BMPR2 protein contains 1038 amino acids and a transmembrane domain (151-171 a.a.) . BMPR-II Protein, Human (HEK293, His) is the extracellular part of the complete BMPR2 protein, produced by HEK293 cells (S27-I151) with C-terminal 6*His-tag.

  • Molecular Formula

    659 (Gene_ID) Q13873-1 (S27-I151) (Accession)

  • Smiles

    SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIHHHHHH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0184600-01
10 µgQM-0184600-01
£91.38/ea
£0.00
£91.38/ea £0.00
50 µgQM-0184600-02
50 µgQM-0184600-02
£266.27/ea
£0.00
£266.27/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BMPR-II, Human (HEK293, His)

BMPR-II, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.