Skip to product information
1 of 1

BMPR1A/ALK-3, Mouse (HEK293, His-Fc)

BMPR1A/ALK-3, Mouse (HEK293, His-Fc)

Size

SKU:QM-0187809-01

£101.50 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    BMPR1A/ALK-3 protein (ACVRLK3) is the receptor bone morphogenetic protein (BMP) type I receptors, widely expressed in tissues[1]. BMPR1A/ALK-3 protein mediates iron metabolism factor hepcidin expression, interacts with GDF5/6 to regulate chondrocyte differentiation and adipogenesis[2][3]. BMPR1A-ID2/ZEB1-TGFBR2 signaling axis could serve as a potentia target for pulmonary arterial hypertension (PAH) and other endothelial-mesenchymal transition (EndoMT) -related vascular disorders[4]. Mouse BMPR1A/ALK-3 has a full length of 532 a.a., with a motif (107-109 a.a.) mediating specificity for BMP ligand. BMPR1A/ALK-3 Protein, Mouse (HEK293, His-Fc) is produced in HEK293 cells and has 129 amino acids (Q24-R152), with C-terminal Fc and His-tags.

  • Molecular Formula

    12166 (Gene_ID) P36895 (Q24-R152) (Accession)

  • Smiles

    QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0187809-01
10 µgQM-0187809-01
£101.50/ea
£0.00
£101.50/ea £0.00
50 µgQM-0187809-02
50 µgQM-0187809-02
£227.39/ea
£0.00
£227.39/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

BMPR1A/ALK-3, Mouse (HEK293, His-Fc)

BMPR1A/ALK-3, Mouse (HEK293, His-Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.