Brorin/VWC2, Human (HEK293, His)

Name: Brorin/VWC2, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0202521-01
Price: 58.12 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0202521-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.
Molecular Formula
375567 (Gene_ID) Q2TAL6 (S28-M325) (Accession)
Smiles
SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0202521-01	5 µgQM-0202521-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0202521-02	10 µgQM-0202521-02 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0202521-03	50 µgQM-0202521-03 £238.32/ea	£0.00	Quantity	£238.32/ea	£0.00

100 µgQM-0202521-04	100 µgQM-0202521-04 £370.76/ea	£0.00	Quantity	£370.76/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

Brorin/VWC2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.