Skip to product information
1 of 1

Bst DNA Polymerase, Geobacillus stearothermophilus (His)

Bst DNA Polymerase, Geobacillus stearothermophilus (His)

Size

SKU:QM-0086922

Price on request
Quantity

Request quote or documents

View full details
  • Description

    Bst DNA Polymerase protein, featuring polymerase and 5'-3' exonuclease activities, exhibits versatile nucleic acid processing capabilities. Beyond synthesizing DNA strands, it adeptly removes nucleotides from the 5' to 3' direction. These dual functions render Bst DNA Polymerase pivotal in molecular biology applications, ensuring efficient DNA amplification and modification processes. Bst DNA Polymerase Protein, Geobacillus stearothermophilus (His) is the recombinant Bst DNA Polymerase protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    / (Gene_ID) E1C9K5 (F301-K876) (Accession)

  • Smiles

    DQSLFAIADSVTDEMLADKAALVVEVVGDNYHHAPIVGIALANERGRFFLRPETALADPKFLAWLGDETKKKTMFDSKRAAVALKWKGIELRGVVFDLLLAAYLLDPAQAAGDVAAVAKMHQYEAVRSDEAVYGKGAKRTVPDEPTLAEHLVRKAAAIWALEEPLMDELRRNEQDRLLTELEQPLAGILANMEFTGVKVDTKRLEQMGAELTEQLQAVERRIYELAGQEFNINSPKQLGTVLFDKLQLPVLKKTKTGYSTSADVLEKLAPHHEIVEHILHYRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQALTQTGRLSSVEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELRVLAHIAEDDNLIEAFRRGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYGLAQNLNITRKEAAEFIERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPIQGSAADIIKKAMIDLSVRLREERLQARLLLQVHDELILEAPKEEIERLCRLVPEVMEQAVTLRVPLKVDYHYGPTWYDAK

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0086922
1 EachQM-0086922
£0.00/ea
£0.00
£0.00/ea £0.00

Bst DNA Polymerase, Geobacillus stearothermophilus (His)

Bst DNA Polymerase, Geobacillus stearothermophilus (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.