Bst DNA Polymerase, Geobacillus stearothermophilus (His)
Bst DNA Polymerase, Geobacillus stearothermophilus (His)
SKU:QM-0086922
Request quote or documents

Product Details
-
Description
Bst DNA Polymerase protein, featuring polymerase and 5'-3' exonuclease activities, exhibits versatile nucleic acid processing capabilities. Beyond synthesizing DNA strands, it adeptly removes nucleotides from the 5' to 3' direction. These dual functions render Bst DNA Polymerase pivotal in molecular biology applications, ensuring efficient DNA amplification and modification processes. Bst DNA Polymerase Protein, Geobacillus stearothermophilus (His) is the recombinant Bst DNA Polymerase protein, expressed by E. coli , with N-6*His labeled tag.
-
Molecular Formula
/ (Gene_ID) E1C9K5 (F301-K876) (Accession)
-
Smiles
DQSLFAIADSVTDEMLADKAALVVEVVGDNYHHAPIVGIALANERGRFFLRPETALADPKFLAWLGDETKKKTMFDSKRAAVALKWKGIELRGVVFDLLLAAYLLDPAQAAGDVAAVAKMHQYEAVRSDEAVYGKGAKRTVPDEPTLAEHLVRKAAAIWALEEPLMDELRRNEQDRLLTELEQPLAGILANMEFTGVKVDTKRLEQMGAELTEQLQAVERRIYELAGQEFNINSPKQLGTVLFDKLQLPVLKKTKTGYSTSADVLEKLAPHHEIVEHILHYRQLGKLQSTYIEGLLKVVHPVTGKVHTMFNQALTQTGRLSSVEPNLQNIPIRLEEGRKIRQAFVPSEPDWLIFAADYSQIELRVLAHIAEDDNLIEAFRRGLDIHTKTAMDIFHVSEEDVTANMRRQAKAVNFGIVYGISDYGLAQNLNITRKEAAEFIERYFASFPGVKQYMDNIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERTAMNTPIQGSAADIIKKAMIDLSVRLREERLQARLLLQVHDELILEAPKEEIERLCRLVPEVMEQAVTLRVPLKVDYHYGPTWYDAK
-
Shipping Conditions
Dry ice.
Related Products
Other industry favorites
Bst DNA Polymerase, Geobacillus stearothermophilus (His)
Bst DNA Polymerase, Geobacillus stearothermophilus (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.